// This file is part of BULL, a program for phylogenetic simulations // most of the code was written by Mark T. Holder. // It is distributed in the hope that it will be useful, // but WITHOUT ANY WARRANTY; without even the implied warranty of // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. // // Some of the code is from publically available source by Paul Lewis, Ziheng Yang, // John Huelsenbeck, David Swofford , and others (as noted in the code). // In fact the main structure of the program was created by modifying Paul Lewis' // basiccmdline.cpp from his NCL // // This code was used in Mark's dissertation, some changes were made in order to // get it to compile on gcc. It is possible that this porting introduced bugs (very // little debugging has been done on UNIX platforms). I would suggest checking // the simulator by generating data on trees with short branches, etc. #include "basic_bull.hpp" #include "char_encoding.hpp" #include "genetic_codes.hpp" #include "string_extensions.hpp" using namespace bull; char *dnaOrdToDNANex[]={"A","C","G","T","-"}; char *aaOrdToAANex[]={"A","C","D","E","F","G","H","I","K","L","M","N","P","Q","R","S","T","V","W","Y","*"}; char *codonOrdToDNANex[]={ "AAA","AAC","AAG","AAT","ACA","ACC","ACG","ACT","AGA","AGC","AGG","AGT","ATA","ATC","ATG","ATT", "CAA","CAC","CAG","CAT","CCA","CCC","CCG","CCT","CGA","CGC","CGG","CGT","CTA","CTC","CTG","CTT", "GAA","GAC","GAG","GAT","GCA","GCC","GCG","GCT","GGA","GGC","GGG","GGT","GTA","GTC","GTG","GTT", "TAA","TAC","TAG","TAT","TCA","TCC","TCG","TCT","TGA","TGC","TGG","TGT","TTA","TTC","TTG","TTT"}; GeneticCode MitoCode("FSYCFSYCLS*WLS*WLPHRLPHRLPQRLPQRITNSITNSMTK*MTK*VADGVADGVAEGVAEG",EncodingType(MitoCodons)); GeneticCode NucCode("FSYCFSYCLS**LS*WLPHRLPHRLPQRLPQRITNSITNSITKRMTKRVADGVADGVAEGVAEG",EncodingType(NucCodons)); int bull::DecodeDNACharInOneChar(short c,bool keepGap/*=false*/) { switch(c) { case 1 : return 'A'; case 2 : return 'C'; case 4 : return 'G'; case 8 : return 'T'; case 15 : return 'N'; case 16 : if (keepGap) return '-'; else throw MTHException("Incorrect DNA Character"); case 5 : return 'R'; case 10 : return 'Y'; case 3 : return 'M'; case 6 : return 'S'; case 7 : return 'V'; case 9 : return 'W'; case 11 : return 'H'; case 12 : return 'K'; case 13 : return 'D'; case 14 : return 'B'; case 31 : if (keepGap) return '-'; //else falls through to throw exception default : throw MTHException("Incorrect DNA Character"); } return(0); } int *bull::GetCodNum(int m) { if (m == EncodingType(MitoCodons)) return MitoCode.GetCodedAANum(); if (m == EncodingType(NucCodons)) return NucCode.GetCodedAANum(); throw MTHException("Unknown genetic code"); } int **bull::GetCodByAA(int m) { if (m == EncodingType(MitoCodons)) return MitoCode.GetCodonsByAA(); if (m == EncodingType(NucCodons)) return NucCode.GetCodonsByAA(); throw MTHException("Unknown genetic code"); } int *bull::GetNCodByAA(int m) { if (m == EncodingType(MitoCodons)) return MitoCode.GetNCodByAA(); if (m == EncodingType(NucCodons)) return NucCode.GetNCodByAA(); throw MTHException("Unknown genetic code"); } char **bull::GetOrdinationToNexusTranslator(int fromType,int toType) { if (toType == EncodingType(DNANoGap)) {if(fromType == EncodingType(DNANoGap)) return dnaOrdToDNANex; if (fromType == EncodingType(MitoCodons) || fromType == EncodingType(NucCodons)) return codonOrdToDNANex; throw MTHException("The requested OrdToNexTranslator hasn't been written yet"); } if (toType == EncodingType(AminoAcid)) {if(fromType == EncodingType(AminoAcid)) return aaOrdToAANex; else if (fromType == EncodingType(MitoCodons)) return MitoCode.GetCodonOrdToAANex(); else if (fromType == EncodingType(NucCodons)) return NucCode.GetCodonOrdToAANex(); throw MTHException("The requested OrdToNexTranslator hasn't been written yet"); } throw MTHException("The requested OrdToNexTranslator hasn't been written yet"); } std::string bull::DecodeDNACharAsStr(short c,bool keepGap/*=false*/) { std::string retstr; retstr=(char) DecodeDNACharInOneChar(c,keepGap); return retstr; } std::string bull::DecodeProteinCharAsStr(short *c, bool keepGap/*=false*/) { try { const int i = DecodeProteinCharInOneChar(c, keepGap); std::string s; AppendInt(s, i); return s; } catch (MTHException){}//not just one character or a standard one character ambiguity code short smask=1,temp[2]; temp[1]=0; std::string retstr="("; for (int i=0; i < 16; i++) {if(*c&smask) {temp[0]=smask; retstr+=(char) DecodeProteinCharInOneChar(temp,keepGap); } smask <<= 1; } smask=1; c++; temp[0]=0; for (int i=0; i < 6; i++) {if(*c&smask) {temp[1]=smask; retstr+=(char) DecodeProteinCharInOneChar(temp,keepGap); } smask <<= 1; } retstr+=")"; return retstr; } int bull::DecodeProteinCharInOneChar(short *c,bool keepGap/*=false*/) { short maxs=16384; maxs <<= 1; //maxs == 1000 0000 0000 0000 if (c[1] == 0) switch(*c) {case 1 : return 'A'; case 2 : return 'C'; case 4 : return 'D'; case 8 : return 'E' ; case 16 : return 'F' ; case 32 : return 'G' ; case 64 : return 'H' ; case 128 : return 'I' ; case 256 : return 'K' ; case 512 : return 'L' ; case 1024 : return 'M' ; case 2048 : return 'N' ; case 4096 : return 'P'; case 8192 : return 'Q'; case 16384 : return 'R' ; default : if (*c == maxs) return 'S'; throw MTHException("Incorrect Protein Character"); } if ((*c) == 0) switch(c[1]) {case 1 : return 'T'; case 2 : return 'V'; case 4 : return 'W'; case 8 : return 'Y'; case 16 : return '*'; case 32 : if (keepGap) return '-'; //else is the fall through exception default : throw MTHException("Incorrect Protein Character"); } if (c[0] == ~0) {if(keepGap && c[1] == 31) return 'X'; if (!keepGap && c[1] == 63) return '?'; throw MTHException("Incorrect Protein Character"); } if (c[0] == 2052 && c[1] == 0) return 'B'; if (c[0] == 8200 && c[1] == 0) return 'Z'; throw MTHException("Incorrect Protein Character"); } std::string bull::NexusNameOfEncoding(int i) { std::string tn; if (i == EncodingType(DNANoGap) || i == EncodingType(MitoCodons) || i == EncodingType(NucCodons)) tn="DNA"; if (i == EncodingType(AminoAcid)) tn="PROTEIN"; return tn; } int bull::NumDNACharactersPerCharacter(int i) { if (i == EncodingType(DNANoGap)) return 1; if (i == EncodingType(MitoCodons) || i == EncodingType(NucCodons)|| i == EncodingType(AminoAcid)) return 3; throw UnknownEncoding("Not DNANogap Or Codons Or Amino Acid encoding"); return 0; } int bull::NumColumnsPerCharacter(int i) { if (i == EncodingType(DNANoGap) || i == EncodingType(AminoAcid)) return 1; if (i == EncodingType(MitoCodons) || i == EncodingType(NucCodons)) return 3; throw UnknownEncoding("Not DNANogap Or Codons Or Amino Acid encoding"); return 0; } std::string bull::DecodeState(short *inp,int datatype) { if (datatype == EncodingType(AminoAcid)) return DecodeProteinCharAsStr(inp,true); else if (datatype == EncodingType(DNANoGap)) return DecodeDNACharAsStr(*inp,true); throw MTHException("Entered unwritten code DecodeState" ); }